Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LY86 Peptide - N-terminal region

LY86 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MD1, MD-1, MMD-1, dJ80N2.1

UniProt

O95711

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004262.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proliferin-3 CRISPR/Cas9 KO Plasmid (m)
sc-424055 20 µg

Proliferin-3 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
14-3-3 γ Antibody
orb194049-01 50 μL

14-3-3 γ Antibody

Sign In for Pricing
View Details
14-3-3 γ Antibody
orb194049-02 100 µL

14-3-3 γ Antibody

Sign In for Pricing
View Details
Methamphetamine (p) -BTG Antigen
ND-R0113 1 Each

Methamphetamine (p) -BTG Antigen

Sign In for Pricing
View Details
VSTM1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2434312 100 µL

VSTM1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Anti-human AXL / UFO (Enapotamab Biosimilar)
BIO0517SM-20mg 20 mg

Anti-human AXL / UFO (Enapotamab Biosimilar)

Sign In for Pricing
View Details