Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITM2A Peptide - middle region

ITM2A Peptide - middle region

Product Specifications

Product Name Alternative

E25A, BRICD2A

UniProt

O43736

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001165052.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGLSFILAGLIVGGACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP17L1 Antibody
orb1558527-01 50 μL

USP17L1 Antibody

Sign In for Pricing
View Details
USP17L1 Antibody
orb1558527-02 100 µL

USP17L1 Antibody

Sign In for Pricing
View Details
USP17L1 Antibody
orb1558527-03 200 µL

USP17L1 Antibody

Sign In for Pricing
View Details
ZNF488 Antibody
29-161 100 µL

ZNF488 Antibody

Sign In for Pricing
View Details
SMC3 Protein Vector (Human) (pPM-C-HA)
PV039183 500 ng

SMC3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Tektip1 Pre-designed siRNA Set A
SI114433A 1 Each

Mouse Tektip1 Pre-designed siRNA Set A

Sign In for Pricing
View Details