What is the catalog number for CHST3 Peptide - middle region?

The catalog number for CHST3 Peptide - middle region is orb2001486.

What sizes are available for CHST3 Peptide - middle region?

CHST3 Peptide - middle region is available in the following size(s): 100 µg.

Is CHST3 Peptide - middle region in stock?

CHST3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CHST3 Peptide - middle region

Product Specifications

Product Name Alternative

HSD, C6ST, C6ST1

UniProt

Q7LGC8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR40635 1 Each

1-Benzyl-4-chloropiperidine hydrochloride

Sign In for Pricing

View Details

EIA07918h 96 Well

Human Fibroblast Growth Factor 22 (FGF22) ELISA kit

Sign In for Pricing

View Details

PV324845 500 ng

ATM Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing

View Details

DL-GDF2-Ra-01 48 Tests

Rat Growth Differentiation Factor 2 (GDF2) ELISA Kit

Sign In for Pricing

View Details

DL-GDF2-Ra-02 96 Tests

Rat Growth Differentiation Factor 2 (GDF2) ELISA Kit

Sign In for Pricing

View Details

MBS8318095-01 10 nmol

hsa-miR-6744-3p miRNA Antagomir

Sign In for Pricing

View Details