What is the catalog number for CHST3 Peptide - middle region?

The catalog number for CHST3 Peptide - middle region is orb2001486.

What sizes are available for CHST3 Peptide - middle region?

CHST3 Peptide - middle region is available in the following size(s): 100 µg.

Is CHST3 Peptide - middle region in stock?

CHST3 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CHST3 Peptide - middle region

Product Specifications

Product Name Alternative

HSD, C6ST, C6ST1

UniProt

Q7LGC8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004264.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSELDSAFSQLQSRLRNLSLQLGVEPAMEAAGEEEEEQRKEEEPPRPAVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-144619-PR 10 µM - 20 µL

EIF4E2 (m) -PR

Sign In for Pricing

View Details

OAPB00408-100UG-FITC 0.1 mg

IL17D Antibody : FITC (OAPB00408-FITC)

Sign In for Pricing

View Details

bs-4572R-PerCP 100 µL

VEGFA Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing

View Details

orb1378752 20 µg

GBP1 Human Over-expression Lysate

Sign In for Pricing

View Details

TL505896V 500 µL Each

Pkn2 Mouse shRNA Lentiviral Particle (Locus ID 109333)

Sign In for Pricing

View Details

LV736661 1.0 µg DNA

OASD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details