Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG7 Peptide - middle region

SPAG7 Peptide - middle region

Product Specifications

Product Name Alternative

ACRP, FSA-1

UniProt

O75391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004881.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human EmL2 activation kit by CRISPRa
GA108508 1 Kit

Human EmL2 activation kit by CRISPRa

Sign In for Pricing
View Details
3-amino-4-propoxy-Benzoic acid
TRC-A699340-50MG 50 mg

3-amino-4-propoxy-Benzoic acid

Sign In for Pricing
View Details
Recombinant Human TDGF1 Protein (Fc Tag)
PKSH033100-01 10 µg

Recombinant Human TDGF1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human TDGF1 Protein (Fc Tag)
PKSH033100-02 50 µg

Recombinant Human TDGF1 Protein (Fc Tag)

Sign In for Pricing
View Details
Human Myotilin (MYOT) activation kit by CRISPRa
GA106349 1 Kit

Human Myotilin (MYOT) activation kit by CRISPRa

Sign In for Pricing
View Details
FGFR4 (NM_213647) Human Over-expression Lysate
LY403876 100 µg

FGFR4 (NM_213647) Human Over-expression Lysate

Sign In for Pricing
View Details