Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG7 Peptide - middle region

SPAG7 Peptide - middle region

Product Specifications

Product Name Alternative

ACRP, FSA-1

UniProt

O75391

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004881.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin-8 Antibody
KC-1064-01 50 μL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1064-02 100 µL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1064-03 1 mL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate
LY424901 100 µg

glucose 6 phosphatase, catalytic subunit (G6PC) (NM_000151) Human Over-expression Lysate

Sign In for Pricing
View Details
EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: SPM533]
AM50141PU-S 100 µg

EMA (MUC1) Mouse Monoclonal Antibody [Clone ID: SPM533]

Sign In for Pricing
View Details
TMEM163 Human Gene Knockout Kit (CRISPR)
KN205533BN 1 Kit

TMEM163 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details