Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF3 Peptide - middle region

GDF3 Peptide - middle region

Product Specifications

Product Name Alternative

KFS3, MCOP7, MCOPCB6

UniProt

Q9NR23

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065685.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5C 3'UTR Luciferase Stable Cell Line
TU011177 1.0 mL

INPP5C 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
FGFR1 Recombinant Rabbit mAb
BS46041-01 50 µL

FGFR1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
FGFR1 Recombinant Rabbit mAb
BS46041-02 100 µL

FGFR1 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human TTC32 Protein
orb429033-01 5 µg

Human TTC32 Protein

Sign In for Pricing
View Details
Human TTC32 Protein
orb429033-02 20 µg

Human TTC32 Protein

Sign In for Pricing
View Details
Human TTC32 Protein
orb429033-03 1 mg

Human TTC32 Protein

Sign In for Pricing
View Details