Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIN1 Peptide - N-terminal region

RIN1 Peptide - N-terminal region

Product Specifications

UniProt

Q13671

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004283.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Contactin-3 Antibody
NBP1-89971-25ul 25 µL

Rabbit Polyclonal Contactin-3 Antibody

Sign In for Pricing
View Details
NUDT18 Protein Vector (Rat) (pPM-C-His)
PV286389 500 ng

NUDT18 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
NHP XL Cytokine Magnetic Luminex Performance Premixed Panel
FCSTM21-34 1 Kit

NHP XL Cytokine Magnetic Luminex Performance Premixed Panel

Sign In for Pricing
View Details
Fmoc-allo-Thr-OH
B-3100.0001 1.0g

Fmoc-allo-Thr-OH

Sign In for Pricing
View Details
Recombinant ASFV F778R Protein, N-His
MBS1576128-01 0.1 mg

Recombinant ASFV F778R Protein, N-His

Sign In for Pricing
View Details
Recombinant ASFV F778R Protein, N-His
MBS1576128-02 1 mg

Recombinant ASFV F778R Protein, N-His

Sign In for Pricing
View Details