RIN1 Peptide - N-terminal region
RIN1 Peptide - N-terminal region
Product Specifications
UniProt
Q13671
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_004283.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9903246-01 48 Well
Mouse cAMP-Specific 3',5'-Cyclic Phosphodiesterase 7B (PDE7B) ELISA Kit
Sign In for Pricing
View Details MBS9903246-02 96 Well
Mouse cAMP-Specific 3',5'-Cyclic Phosphodiesterase 7B (PDE7B) ELISA Kit
Sign In for Pricing
View Details MBS9903246-03 5x 96 Well
Mouse cAMP-Specific 3',5'-Cyclic Phosphodiesterase 7B (PDE7B) ELISA Kit
Sign In for Pricing
View Details MBS9903246-04 10x 96 Well
Mouse cAMP-Specific 3',5'-Cyclic Phosphodiesterase 7B (PDE7B) ELISA Kit
Sign In for Pricing
View Details 
