Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNA14 Peptide - C-terminal region

GNA14 Peptide - C-terminal region

Product Specifications

UniProt

O95837

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004288.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf166 Antibody
orb1331283 100 µg

C14orf166 Antibody

Sign In for Pricing
View Details
Recombinant Human FBXO7 Protein - (Dry Ice)
H00025793-Q01-10ug 10 µg

Recombinant Human FBXO7 Protein - (Dry Ice)

Sign In for Pricing
View Details
DNAJB11 Rabbit pAb
E45R19530N-100 100 µL

DNAJB11 Rabbit pAb

Sign In for Pricing
View Details
Rat Serine/Threonine-Protein Kinase PLK1 (PLK1) ELISA Kit
abx518106 96 Tests

Rat Serine/Threonine-Protein Kinase PLK1 (PLK1) ELISA Kit

Sign In for Pricing
View Details
ALDH16A1 Rabbit Monoclonal Antibody
E28G1753 100 µL

ALDH16A1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Ropporin 1-like Antibody [DyLight 350]
NBP2-99172UV 0.1 mL

Rabbit Polyclonal Ropporin 1-like Antibody [DyLight 350]

Sign In for Pricing
View Details