What is the catalog number for GNA14 Peptide - C-terminal region?

The catalog number for GNA14 Peptide - C-terminal region is orb2001480.

What sizes are available for GNA14 Peptide - C-terminal region?

GNA14 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is GNA14 Peptide - C-terminal region in stock?

GNA14 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

GNA14 Peptide - C-terminal region

Product Specifications

UniProt

O95837

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_004288.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TP312324L 1 mg

RED1 (ADARB1) (NM_015833) Human Recombinant Protein

Sign In for Pricing

View Details

NBP3-08897AF594 100 µL

Mouse Monoclonal TYRP1 Antibody (TYRP1/3281) [Alexa Fluor 594]

Sign In for Pricing

View Details

8C0308-AAT 50 µg

Presenilin 1 Antibody

Sign In for Pricing

View Details

SR403072 1 Kit

EG668313 Mouse siRNA Oligo Duplex (Locus ID 668313)

Sign In for Pricing

View Details

DY1669 15 Plates

Human Serpin A4/Kallistatin DuoSet ELISA

Sign In for Pricing

View Details

QM34214S 200 Tests

Mouse Isoc2b qPCR Primer Pair

Sign In for Pricing

View Details