Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCC2 Peptide - middle region

GCC2 Peptide - middle region

Product Specifications

Product Name Alternative

REN53, GCC185, RANBP2L4

UniProt

Q8IWJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_852118.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLYEENNKLSSEKKQLSRDLEVFLSQKEDVILKEHITQLEKKLQLMVEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNA3 Rabbit Polyclonal Antibody (AP)
orb2420350 100 µL

KCNA3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Human Omentin
MBS142178-01 0.002 mg

Recombinant Human Omentin

Sign In for Pricing
View Details
Recombinant Human Omentin
MBS142178-02 0.01 mg

Recombinant Human Omentin

Sign In for Pricing
View Details
Recombinant Human Omentin
MBS142178-03 1 mg

Recombinant Human Omentin

Sign In for Pricing
View Details
Recombinant Human Omentin
MBS142178-04 5x 1 mg

Recombinant Human Omentin

Sign In for Pricing
View Details
Lentiviral human WWOX shRNA (UAS) - Lentiviral human WWOX shRNA (UAS, GFP) plasmid
GTR15318157 1 Vial

Lentiviral human WWOX shRNA (UAS) - Lentiviral human WWOX shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details