Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCC2 Peptide - middle region

GCC2 Peptide - middle region

Product Specifications

Product Name Alternative

REN53, GCC185, RANBP2L4

UniProt

Q8IWJ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_852118.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLYEENNKLSSEKKQLSRDLEVFLSQKEDVILKEHITQLEKKLQLMVEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPDP-PEG36-NHS ester
T18713-01 100 mg

SPDP-PEG36-NHS ester

Sign In for Pricing
View Details
SPDP-PEG36-NHS ester
T18713-02 500 mg

SPDP-PEG36-NHS ester

Sign In for Pricing
View Details
Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)
MBS2104629-01 5x 96 Tests

Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)
MBS2104629-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)
MBS2104629-03 10x 96 Tests

Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)
MBS2104629-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Keratin 28 (KRT28) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details