Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAFB2 Peptide - middle region

SAFB2 Peptide - middle region

Product Specifications

UniProt

Q14151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055464.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (4-α-Cumylphenoxy) phthalonitrile
sc-485521 1 g

4- (4-α-Cumylphenoxy) phthalonitrile

Sign In for Pricing
View Details
Lrg1 Polyclonal Antibody
CAC07387-01 50 µg

Lrg1 Polyclonal Antibody

Sign In for Pricing
View Details
Lrg1 Polyclonal Antibody
CAC07387-02 100 µg

Lrg1 Polyclonal Antibody

Sign In for Pricing
View Details
PSMG3 Antibody
GWB-MV967D 50 µg

PSMG3 Antibody

Sign In for Pricing
View Details
Bbs1 (NM_001033128) Mouse Tagged Lenti ORF Clone
MR215141L3 10 µg

Bbs1 (NM_001033128) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Chaetomium globosum Class E vacuolar protein-sorting machinery protein HSE1 (HSE1), partial
MBS1306934 Inquire

Recombinant Chaetomium globosum Class E vacuolar protein-sorting machinery protein HSE1 (HSE1), partial

Sign In for Pricing
View Details