Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAFB2 Peptide - middle region

SAFB2 Peptide - middle region

Product Specifications

UniProt

Q14151

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055464.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RGQYQDHAIDRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camptothecin
1100/25 25 mg

Camptothecin

Sign In for Pricing
View Details
Recombinant Borrelia Hermsii rpsT Protein (aa 1-85)
VAng-Lsx2268-50gEcoli 50 µg (E. coli)

Recombinant Borrelia Hermsii rpsT Protein (aa 1-85)

Sign In for Pricing
View Details
ALCAM Recombinant Monoclonal Antibody
CSB-RA437652A0HU-01 50 μL

ALCAM Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
ALCAM Recombinant Monoclonal Antibody
CSB-RA437652A0HU-02 100 µL

ALCAM Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Bacillus cereus Ornithine aminotransferase (rocD)
MBS1291780-01 0.02 mg (E-Coli)

Recombinant Bacillus cereus Ornithine aminotransferase (rocD)

Sign In for Pricing
View Details
Recombinant Bacillus cereus Ornithine aminotransferase (rocD)
MBS1291780-02 0.02 mg (Yeast)

Recombinant Bacillus cereus Ornithine aminotransferase (rocD)

Sign In for Pricing
View Details