What is the catalog number for IPO13 Peptide - middle region?

The catalog number for IPO13 Peptide - middle region is orb2001477.

What sizes are available for IPO13 Peptide - middle region?

IPO13 Peptide - middle region is available in the following size(s): 100 µg.

Is IPO13 Peptide - middle region in stock?

IPO13 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

IPO13 Peptide - middle region

Product Specifications

Product Name Alternative

LGL2, IMP13, KAP13, RANBP13

UniProt

O94829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055467.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb981909 100 µL

IMPDH2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing

View Details

E45R26473N-50 50 µL

GRK6 Rabbit pAb

Sign In for Pricing

View Details

sc-421798-LAC 200 µL

Myosin Va Lentiviral Activation Particles (m)

Sign In for Pricing

View Details

NBP1-45027SS 0.025 mg

Mouse Monoclonal TRAIL R4/TNFRSF10D/DcR2 Antibody (TRAIL-R4-01) - Azide Free

Sign In for Pricing

View Details

TA506108AM 100 µL

MEK1 (MAP2K1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E6]

Sign In for Pricing

View Details

MBS1436709-01 0.02 mg (E-Coli)

Recombinant Rhizobium meliloti Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing

View Details