What is the catalog number for IPO13 Peptide - middle region?

The catalog number for IPO13 Peptide - middle region is orb2001477.

What sizes are available for IPO13 Peptide - middle region?

IPO13 Peptide - middle region is available in the following size(s): 100 µg.

Is IPO13 Peptide - middle region in stock?

IPO13 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

IPO13 Peptide - middle region

Product Specifications

Product Name Alternative

LGL2, IMP13, KAP13, RANBP13

UniProt

O94829

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055467.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HKAQFPSDEEYGFWSSDEKEQFRIYRVDISDTLMYVYEMLGAELLSNLYD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-99072PE 0.1 mL

Rabbit Polyclonal IRF6 Antibody [PE]

Sign In for Pricing

View Details

NBP2-99136APC 0.1 mL

Rabbit Polyclonal Fc gamma RIIB/CD32b Antibody [Allophycocyanin]

Sign In for Pricing

View Details

orb1564810-01 20 ul

HNRNPA1L2 Rabbit mAb

Sign In for Pricing

View Details

orb1564810-02 50 µL

HNRNPA1L2 Rabbit mAb

Sign In for Pricing

View Details

orb1564810-03 100 µL

HNRNPA1L2 Rabbit mAb

Sign In for Pricing

View Details

AAP56159-100UG 100 µg

Tex11 Peptide - N-terminal region (AAP56159)

Sign In for Pricing

View Details