Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNPH Peptide - N-terminal region

SNPH Peptide - N-terminal region

Product Specifications

Product Name Alternative

BA314N13.5

UniProt

O15079

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055538.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC25B Rabbit Polyclonal Antibody
AP13959PU-N 400 µL

CDC25B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl Acid Tartrate
TRC-E679620-25MG 25 mg

Ethyl Acid Tartrate

Sign In for Pricing
View Details
2,2,2-Trifluoroethyl Trifluoroacetate
TRC-T790310-5G 5 g

2,2,2-Trifluoroethyl Trifluoroacetate

Sign In for Pricing
View Details
Human Lipocalin-2 Recombinant Rabbit monoclonal Antibody
HA725110 100 µL

Human Lipocalin-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
LPHN1 Antibody
8G377-AAT 50 µg

LPHN1 Antibody

Sign In for Pricing
View Details
Recombinant Human KEAP1/INRF2 Protein (His & GST & AVI Tag)
PKSH030944 100 µg

Recombinant Human KEAP1/INRF2 Protein (His & GST & AVI Tag)

Sign In for Pricing
View Details