Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNPH Peptide - N-terminal region

SNPH Peptide - N-terminal region

Product Specifications

Product Name Alternative

BA314N13.5

UniProt

O15079

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055538.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPPVSVRDAYGTSSLSSSSNSGSYKGSDSSPTPRRSMKYTLCSDNHGIKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI1 Polyclonal Antibody
E-AB-12222-01 20 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details
ABI1 Polyclonal Antibody
E-AB-12222-02 60 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details
ABI1 Polyclonal Antibody
E-AB-12222-03 120 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details
ABI1 Polyclonal Antibody
E-AB-12222-04 200 µL

ABI1 Polyclonal Antibody

Sign In for Pricing
View Details
PGD (NM_002631) Human Over-expression Lysate
LY419202 100 µg

PGD (NM_002631) Human Over-expression Lysate

Sign In for Pricing
View Details
Pergafast 201-d4
TRC-P287182-10MG 10 mg

Pergafast 201-d4

Sign In for Pricing
View Details