Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX17 Peptide - middle region

SNX17 Peptide - middle region

Product Specifications

UniProt

Q15036

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001253989.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT10 Rabbit Polyclonal Antibody
TA369226 100 µL

NAT10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]
E-AB-F1139I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD45RO Antibody[UCHL1]

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), 0.2mg/mL
BNUB2342-500 1x 500 µL

Calcineurin B / PPP3R1 (CALNB/2342), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human Frizzled-5/FZD5 Protein (His Tag)
PKSH031583 100 µg

Recombinant Human Frizzled-5/FZD5 Protein (His Tag)

Sign In for Pricing
View Details