Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX17 Peptide - middle region

SNX17 Peptide - middle region

Product Specifications

UniProt

Q15036

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001253989.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQWVTITS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS509688 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
NTAQ1 (NM_018024) Human Over-expression Lysate
LY402638 100 µg

NTAQ1 (NM_018024) Human Over-expression Lysate

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-01 50 μL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-02 100 µL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
KLK9 Antibody (Biotin)
KB-40034-03 1 mL

KLK9 Antibody (Biotin)

Sign In for Pricing
View Details
PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF568 conjugate, 0.1mg/mL
BNC680889-100 1x 100 µL

PLAP (Placental Alkaline Phosphatase) (PL8-F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details