Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTSS1 Peptide - middle region

MTSS1 Peptide - middle region

Product Specifications

Product Name Alternative

MIM, MIMA, MIMB

UniProt

O43312

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001269900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDWAKPGPYDQPLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPR

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-glycan Labeling and Detection Kit
EA007 1 Kit

N-glycan Labeling and Detection Kit

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)
MBS2053175-01 0.1 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)
MBS2053175-02 0.2 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)
MBS2053175-03 0.5 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)
MBS2053175-04 1 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)
MBS2053175-05 5 mL

HRP-Linked Polyclonal Antibody to Tumor Necrosis Factor Ligand Superfamily, Member 7 (TNFSF7)

Sign In for Pricing
View Details