Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTSS1 Peptide - middle region

MTSS1 Peptide - middle region

Product Specifications

Product Name Alternative

MIM, MIMA, MIMB

UniProt

O43312

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001269900.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDWAKPGPYDQPLVNTLQRRKEKREPDPNGGGPTTASGPPAAAEEAQRPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PZP (Pregnancy Zone Protein) ELISA Kit
EK247128 96 Well

Mouse PZP (Pregnancy Zone Protein) ELISA Kit

Sign In for Pricing
View Details
RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2) (Biotin)
R2022-03A-Biotin 100 µL

RNASE2 (Non-secretory Ribonuclease, Eosinophil-derived Neurotoxin, RNase UpI-2, Ribonuclease 2, RNase 2, Ribonuclease US, EDN, RNS2) (Biotin)

Sign In for Pricing
View Details
Rabbit Monoclonal KIR2DS1/CD158h Antibody (1127B) [FITC]
FAB8887F 0.1 mL

Rabbit Monoclonal KIR2DS1/CD158h Antibody (1127B) [FITC]

Sign In for Pricing
View Details
PUP5 Antibody
orb794610 2 mg

PUP5 Antibody

Sign In for Pricing
View Details
CD146 (MCAM) Human siRNA Oligo Duplex (Locus ID 4162)
SR302830 1 Kit

CD146 (MCAM) Human siRNA Oligo Duplex (Locus ID 4162)

Sign In for Pricing
View Details
Recombinant Escherichia coli Inner membrane protein yedR (yedR), partial
MBS7058358 Inquire

Recombinant Escherichia coli Inner membrane protein yedR (yedR), partial

Sign In for Pricing
View Details