Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPM2AIP1 Peptide - middle region

EPM2AIP1 Peptide - middle region

Product Specifications

UniProt

Q7L775

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055620.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALREVVDELKQQNKEDEKIFDPDRYQMVICRLQKEFERHFKDLRFIKKDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1437 Rat siRNA Oligo Duplex (Locus ID 287325)
SR509538 1 Kit

Olr1437 Rat siRNA Oligo Duplex (Locus ID 287325)

Sign In for Pricing
View Details
Zinc Finger Protein Helios, Recombinant, Mouse, aa1-526, His-Tag, Myc-Tag
586822-01 20 µg

Zinc Finger Protein Helios, Recombinant, Mouse, aa1-526, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Zinc Finger Protein Helios, Recombinant, Mouse, aa1-526, His-Tag, Myc-Tag
586822-02 100 µg

Zinc Finger Protein Helios, Recombinant, Mouse, aa1-526, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Mtnr1al Antibody
orb860489 2 mg

Mtnr1al Antibody

Sign In for Pricing
View Details
APC anti-mouse CD3e
E16FMA004-025U 25 µg

APC anti-mouse CD3e

Sign In for Pricing
View Details
Actoxumab Biosimilar - Research Grade
ICH5326-10mg 10 mg (2x 5 mg)

Actoxumab Biosimilar - Research Grade

Sign In for Pricing
View Details