Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RABGAP1L Peptide - middle region

RABGAP1L Peptide - middle region

Product Specifications

Product Name Alternative

HHL, TBC1D18

UniProt

Q5R372

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001030307.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPDSDVFTFSVSLEVKEDDGKGNFSPVPKDRDKFYFKLKQGIEKKVVITV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (Mucin 2) (MLP/2970R), CF488A conjugate, 0.1mg/mL
BNC882970-500 1x 500 µL

MUC2 (Mucin 2) (MLP/2970R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS629822 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Flufenacet ESA Sodium Salt
TRC-F599428-50MG 50 mg

Flufenacet ESA Sodium Salt

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802Q-01 20 Tests

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802Q-02 100 Tests

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802Q-03 2x 100 Tests

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details