What is the catalog number for ZBTB5 Peptide - middle region?

The catalog number for ZBTB5 Peptide - middle region is orb2001466.

What sizes are available for ZBTB5 Peptide - middle region?

ZBTB5 Peptide - middle region is available in the following size(s): 100 µg.

Is ZBTB5 Peptide - middle region in stock?

ZBTB5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ZBTB5 Peptide - middle region

Product Specifications

UniProt

O15062

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055687.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-264471 25 g

Trifluorovinyl chlorosulphate

Sign In for Pricing

View Details

bsm-33075M 100 µL

CD2 (5H3) Monoclonal Antibody

Sign In for Pricing

View Details

21-406 0.1 mg

Liver Lysate

Sign In for Pricing

View Details

10277024 500 ng

1700125D06Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details

DZ41562-Dylight488 200 µL

Anti-Epstein-Barr Virus BdRF1 Antibody (Dylight488 Conjugate)

Sign In for Pricing

View Details

TRC-M338950-10MG 10 mg

Mesembrine

Sign In for Pricing

View Details