ZBTB5 Peptide - middle region
ZBTB5 Peptide - middle region
Product Specifications
UniProt
O15062
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_055687.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038216-ML750 100 µL
Mastl, ID (Mastl, Gw, Gwl, Serine/threonine-protein kinase greatwall, Microtubule-associated serine/threonine-protein kinase-like) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS6352230-01 0.1 mL
STRN4, NT (STRN4, ZIN, Striatin-4, Zinedin) (MaxLight 405)
Sign In for Pricing
View Details MBS6352230-02 5x 0.1 mL
STRN4, NT (STRN4, ZIN, Striatin-4, Zinedin) (MaxLight 405)
Sign In for Pricing
View Details 
SIPG879Hu01-01 10 µg
Recombinant TNF Receptor Associated Factor 4 (TRAF4)
Sign In for Pricing
View Details SIPG879Hu01-02 50 µg
Recombinant TNF Receptor Associated Factor 4 (TRAF4)
Sign In for Pricing
View Details