ZBTB5 Peptide - middle region
ZBTB5 Peptide - middle region
Product Specifications
UniProt
O15062
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_055687.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLES
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
A16196-1-PE 100 µg/Vial
Anti-PCDHA13 Antibody Picoband®, PE Conjugate
Sign In for Pricing
View Details 
MBS647163-01 0.1 mg
MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B)
Sign In for Pricing
View Details MBS647163-02 5x 0.1 mg
MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B)
Sign In for Pricing
View Details 