Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB5 Peptide - middle region

ZBTB5 Peptide - middle region

Product Specifications

UniProt

O15062

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055687.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HILEVTNNLEHKSTFSISNFLNKSRGNNFTANQNNDDNIPNTTSDCRLES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-mouse CD326 (Ep-CAM)
E16FMF326-050U 50 µg

FITC anti-mouse CD326 (Ep-CAM)

Sign In for Pricing
View Details
HINFP 293 Cell Lysate
403179 0.1 mg

HINFP 293 Cell Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal TAPP1/PLEKHA1 Antibody (16C9)
NBP3-26375-100ul 100 µL

Rabbit Monoclonal TAPP1/PLEKHA1 Antibody (16C9)

Sign In for Pricing
View Details
Ethyl 2- ((Ethoxycarbonothioyl) Thio) Propanoate
OR1013134-01 100 mg

Ethyl 2- ((Ethoxycarbonothioyl) Thio) Propanoate

Sign In for Pricing
View Details
Ethyl 2- ((Ethoxycarbonothioyl) Thio) Propanoate
OR1013134-02 1 g

Ethyl 2- ((Ethoxycarbonothioyl) Thio) Propanoate

Sign In for Pricing
View Details
Ethyl 2- ((Ethoxycarbonothioyl) Thio) Propanoate
OR1013134-03 5 g

Ethyl 2- ((Ethoxycarbonothioyl) Thio) Propanoate

Sign In for Pricing
View Details