What is the catalog number for OXSR1 Peptide - middle region?

The catalog number for OXSR1 Peptide - middle region is orb2001464.

What sizes are available for OXSR1 Peptide - middle region?

OXSR1 Peptide - middle region is available in the following size(s): 100 µg.

Is OXSR1 Peptide - middle region in stock?

OXSR1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

OXSR1 Peptide - middle region

Product Specifications

Product Name Alternative

OSR1

UniProt

O95747

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005100.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVPGSSGRLHKTEDGGWEWSDDEFDEESEEGKAAISQLRSPRVKESISNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

50431164 1.0 µg

Wipf3 AAV siRNA Pooled Vector

Sign In for Pricing

View Details

AMM14130V 100 µL

Hydroxysteroid (17 beta) Dehydrogenase 4 (HSD17B4) Mouse Monoclonal Antibody [Clone ID: LBI2C9]

Sign In for Pricing

View Details

511185 100 µg

LPIN2 (KIAA0249) discontinued

Sign In for Pricing

View Details

E43S48972 100 µL

Amphiphysin Recombinant Rabbit mAb

Sign In for Pricing

View Details

T17190-01 1 mg

U18666A

Sign In for Pricing

View Details

T17190-02 2 mg

U18666A

Sign In for Pricing

View Details