Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTBP3 Peptide - N-terminal region

PTBP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ROD1

UniProt

O95758

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001157260.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR655 Human qPCR Primer Pair (MI0003677)
HP300566 200 Reactions

MIR655 Human qPCR Primer Pair (MI0003677)

Sign In for Pricing
View Details
ZNF330 Human Gene Knockout Kit (CRISPR)
KN400336 1 Kit

ZNF330 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/3121R), CF740 conjugate, 0.1mg/mL
BNC743121-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/3121R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ethyl Ethanesulfonate
TRC-E676565-2.5G 2.5 g

Ethyl Ethanesulfonate

Sign In for Pricing
View Details
Spiramycin I (Contains up to 6% Spiramycin III)
TRC-S682300-2.5G 2.5 g

Spiramycin I (Contains up to 6% Spiramycin III)

Sign In for Pricing
View Details
Cytochrome P450 2D6 (CYP2D6) (NM_001025161) Human Over-expression Lysate
LY422597 100 µg

Cytochrome P450 2D6 (CYP2D6) (NM_001025161) Human Over-expression Lysate

Sign In for Pricing
View Details