Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTBP3 Peptide - N-terminal region

PTBP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ROD1

UniProt

O95758

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001157260.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nrf1 Monoclonal Antibody
E-AB-81588-01 50 µL

Recombinant Nrf1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Nrf1 Monoclonal Antibody
E-AB-81588-02 100 µL

Recombinant Nrf1 Monoclonal Antibody

Sign In for Pricing
View Details
Human PSD3 activation kit by CRISPRa
GA108250 1 Kit

Human PSD3 activation kit by CRISPRa

Sign In for Pricing
View Details
OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF640R conjugate, 0.1mg/mL
BNC402400-100 1x 100 µL

OLIG2 (Marker of Glial Brain Tumors) (OLIG2/2400), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Hexanoic Acid
TRC-H292145-500G 500 g

1-Hexanoic Acid

Sign In for Pricing
View Details
MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF594 conjugate, 0.1mg/mL
BNC941101-500 1x 500 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details