What is the catalog number for ACTR1A Peptide - middle region?

The catalog number for ACTR1A Peptide - middle region is orb2001456.

What sizes are available for ACTR1A Peptide - middle region?

ACTR1A Peptide - middle region is available in the following size(s): 100 µg.

Is ACTR1A Peptide - middle region in stock?

ACTR1A Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

ACTR1A Peptide - middle region

Product Specifications

Product Name Alternative

ARP1, Arp1A, CTRN1

UniProt

P61163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-04022G 0.1 mL

Rabbit Polyclonal TOE1 Antibody [DyLight 488]

Sign In for Pricing

View Details

orb526284 100 µL

Flag Tag Mouse Monoclonal Antibody (HRP)

Sign In for Pricing

View Details

RDR-ALB-Ra-48Tests 48 Tests

Rat Albumin (ALB) ELISA Kit

Sign In for Pricing

View Details

GTR15418987 1 Vial

Human CFAP53 Knockout HEK293T cell line

Sign In for Pricing

View Details

033579-APC 200 µL

CDC25B, ID (CDC25B, CDC25HU2, M-phase inducer phosphatase 2, Dual specificity phosphatase Cdc25B) (APC) discontinued

Sign In for Pricing

View Details

abx952474-01 150 µg

Human ITGAM shRNA Plasmid

Sign In for Pricing

View Details