Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR1A Peptide - middle region

ACTR1A Peptide - middle region

Product Specifications

Product Name Alternative

ARP1, Arp1A, CTRN1

UniProt

P61163

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005727.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N4BP2 HDR Plasmid (h)
sc-412585-HDR 20 µg

N4BP2 HDR Plasmid (h)

Sign In for Pricing
View Details
PDZD9 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV622695 1.0 µg DNA

PDZD9 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Human CD19 Antibody : FITC
OASB00936-100T 100 Tests

Human CD19 Antibody : FITC

Sign In for Pricing
View Details
AGBL2 (NM_024783) Human Tagged ORF Clone Lentiviral Particle
RC206949L3V 200 µL

AGBL2 (NM_024783) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AGR3 antibody
FNab00220 100 µg

AGR3 antibody

Sign In for Pricing
View Details
RWDD1 siRNA (m)
sc-153180 10 µM

RWDD1 siRNA (m)

Sign In for Pricing
View Details