Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPHOSPH10 Peptide - middle region

MPHOSPH10 Peptide - middle region

Product Specifications

Product Name Alternative

CT90, MPP10, MPP10P, PPP1R106

UniProt

O00566

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005782.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETDEDDDLQENEDNKQHKESLKRVTFALPDDAETEDTGVLNVKKNSDEVK

More Discoveries

Explore Other Products

Browse additional items from our catalog

CARD10 Antibody (Center) Blocking Peptide
MBS9220726-01 0.5 mg

CARD10 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
CARD10 Antibody (Center) Blocking Peptide
MBS9220726-02 5x 0.5 mg

CARD10 Antibody (Center) Blocking Peptide

Sign In for Pricing
View Details
Pappa2-set siRNA/shRNA/RNAi Lentivector (Mouse)
35996094 4x 500 ng

Pappa2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
DORFIN (RNF19A) (NM_183419) Human Over-expression Lysate
LS025897-20ug 20 µg

DORFIN (RNF19A) (NM_183419) Human Over-expression Lysate

Sign In for Pricing
View Details
Goat α Fodrin IgG/IgA ELISA Kit
NSL1095Gt 96 Tests

Goat α Fodrin IgG/IgA ELISA Kit

Sign In for Pricing
View Details
Mrps27 (NM_001108543) Rat Tagged Lenti ORF Clone
RR214234L4 10 µg

Mrps27 (NM_001108543) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details