Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC23B Peptide - middle region

SEC23B Peptide - middle region

Product Specifications

Product Name Alternative

CDAII, CDAN2, CDA-II, HEMPAS

UniProt

Q15437

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001166216.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glyt1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-11604R-PerCP-Cy5.5 100 µL

Glyt1 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Hamster 5-Nucleotidase ELISA Kit
MBS038540-01 48 Well

Hamster 5-Nucleotidase ELISA Kit

Sign In for Pricing
View Details
Hamster 5-Nucleotidase ELISA Kit
MBS038540-02 96 Well

Hamster 5-Nucleotidase ELISA Kit

Sign In for Pricing
View Details
Hamster 5-Nucleotidase ELISA Kit
MBS038540-03 5x 96 Well

Hamster 5-Nucleotidase ELISA Kit

Sign In for Pricing
View Details
Hamster 5-Nucleotidase ELISA Kit
MBS038540-04 10x 96 Well

Hamster 5-Nucleotidase ELISA Kit

Sign In for Pricing
View Details
Cdk7 Rat Pre-designed siRNA Set A
HY-RS02397 1 Set

Cdk7 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details