Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC23B Peptide - middle region

SEC23B Peptide - middle region

Product Specifications

Product Name Alternative

CDAII, CDAN2, CDA-II, HEMPAS

UniProt

Q15437

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001166216.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDVLRWLDRQLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human DnaJ homolog subfamily B member 1 polyclonal Antibody
MBS7001205-01 0.05 mg

Rabbit anti-human DnaJ homolog subfamily B member 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DnaJ homolog subfamily B member 1 polyclonal Antibody
MBS7001205-02 0.1 mg

Rabbit anti-human DnaJ homolog subfamily B member 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DnaJ homolog subfamily B member 1 polyclonal Antibody
MBS7001205-03 5x 0.1 mg

Rabbit anti-human DnaJ homolog subfamily B member 1 polyclonal Antibody

Sign In for Pricing
View Details
Cat Phospholipase A2 Receptor 1 ELISA Kit
MBS075460 Inquire

Cat Phospholipase A2 Receptor 1 ELISA Kit

Sign In for Pricing
View Details
SMN2 Rabbit pAb
E45R23114N-100 100 µL

SMN2 Rabbit pAb

Sign In for Pricing
View Details
Canine Ataxin-7 (ATXN7) ELISA Kit
MBS7227817-01 48 Well

Canine Ataxin-7 (ATXN7) ELISA Kit

Sign In for Pricing
View Details