Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGA Peptide - middle region

RRAGA Peptide - middle region

Product Specifications

Product Name Alternative

FIP1, RAGA, FIP-1

UniProt

Q7L523

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_006561.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVES

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metabotropic Glutamate Receptor 2 (GRM2) Human Gene Knockout Kit (CRISPR)
KN418103 1 Kit

Metabotropic Glutamate Receptor 2 (GRM2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPARC (C-term) Rabbit Polyclonal Antibody
AP17759PU-N 400 µL

SPARC (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RPS15A (NM_001030009) Human Over-expression Lysate
LC400408 20 µg

RPS15A (NM_001030009) Human Over-expression Lysate

Sign In for Pricing
View Details
MGC16025 Human qPCR Primer Pair (BC008026)
HP223164 200 Reactions

MGC16025 Human qPCR Primer Pair (BC008026)

Sign In for Pricing
View Details
RBM15 Antibody
KC-3915-01 50 μL

RBM15 Antibody

Sign In for Pricing
View Details
RBM15 Antibody
KC-3915-02 100 µL

RBM15 Antibody

Sign In for Pricing
View Details