Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC17A3 Peptide - middle region

SLC17A3 Peptide - middle region

Product Specifications

Product Name Alternative

NPT4

UniProt

O00476

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001091956.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQNVIMNITMVAMVNSTSPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf74 (NM_001037671) Human Over-expression Lysate
LY421977 100 µg

C12orf74 (NM_001037671) Human Over-expression Lysate

Sign In for Pricing
View Details
GM-CSF Antibody
KC-055-01 50 μL

GM-CSF Antibody

Sign In for Pricing
View Details
GM-CSF Antibody
KC-055-02 100 µL

GM-CSF Antibody

Sign In for Pricing
View Details
GM-CSF Antibody
KC-055-03 1 mL

GM-CSF Antibody

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF740 conjugate, 0.1mg/mL
BNC742378-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9) – Biotium Choice
P016-1MG 1x 500 µL

CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9) – Biotium Choice

Sign In for Pricing
View Details