Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTNL3 Peptide - N-terminal region

BTNL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BTNLR, BTN9.1

UniProt

Q6UXE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_932079.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: right
CS711806 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Rfx4 Mouse Gene Knockout Kit (CRISPR)
KN514708 1 Kit

Rfx4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FCRL4 activation kit by CRISPRa
GA113163 1 Kit

Human FCRL4 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS624755 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
(S)-(+)-Mandelic Acid
TRC-M162535-25G 25 g

(S)-(+)-Mandelic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Muscle tissue
CS704842 5x 5 µm

Tissue FFPE Sections, Muscle tissue

Sign In for Pricing
View Details