Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTNL3 Peptide - N-terminal region

BTNL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BTNLR, BTN9.1

UniProt

Q6UXE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_932079.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVVHLYRDGEDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), Biotin conjugate, 0.1mg/mL
BNCB0149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nonyl Undecyl Phthalate
TRC-B185510-50MG 50 mg

Nonyl Undecyl Phthalate

Sign In for Pricing
View Details
Mix-n-StainTM CF®725 Antibody Labeling Kit, 1x (5-20ug) labeling
#92582 1 Kit

Mix-n-StainTM CF®725 Antibody Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
Agk Mouse Gene Knockout Kit (CRISPR)
KN500977 1 Kit

Agk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dystrobrevin alpha (DTNA) (NM_001392) Human Over-expression Lysate
LY419965 100 µg

Dystrobrevin alpha (DTNA) (NM_001392) Human Over-expression Lysate

Sign In for Pricing
View Details
Perfluoroethylsulphonyl Chloride
TRC-P630540-500MG 500 mg

Perfluoroethylsulphonyl Chloride

Sign In for Pricing
View Details