Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT6 Peptide - middle region

GALNT6 Peptide - middle region

Product Specifications

Product Name Alternative

GalNAcT6, GALNAC-T6

UniProt

Q8NCL4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_009141.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8 Well Non-Skirted PCR Plate Segment, clear PP, high profile, 600 segments per case
4TI-0750/8 600 Strips

8 Well Non-Skirted PCR Plate Segment, clear PP, high profile, 600 segments per case

Sign In for Pricing
View Details
ERK1 Mouse Monoclonal Antibody (4G11)
MBS8594752-01 0.1 mg

ERK1 Mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details
ERK1 Mouse Monoclonal Antibody (4G11)
MBS8594752-02 0.1 mL (AF405L)

ERK1 Mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details
ERK1 Mouse Monoclonal Antibody (4G11)
MBS8594752-03 0.1 mL (AF405S)

ERK1 Mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details
ERK1 Mouse Monoclonal Antibody (4G11)
MBS8594752-04 0.1 mL (AF610)

ERK1 Mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details
ERK1 Mouse Monoclonal Antibody (4G11)
MBS8594752-05 0.1 mL (AF635)

ERK1 Mouse Monoclonal Antibody (4G11)

Sign In for Pricing
View Details