Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT6 Peptide - middle region

GALNT6 Peptide - middle region

Product Specifications

Product Name Alternative

GalNAcT6, GALNAC-T6

UniProt

Q8NCL4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_009141.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P39 siRNA (m)
sc-42157 10 µM

P39 siRNA (m)

Sign In for Pricing
View Details
TTC8 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-11510R-BF488 100 µL

TTC8 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Mouse Immunoglobulin G1
HY-NP0196A 1 Each

Mouse Immunoglobulin G1

Sign In for Pricing
View Details
Recombinant Polistes dominula Dominulin-A
MBS1040687-01 0.05 mg (E-Coli)

Recombinant Polistes dominula Dominulin-A

Sign In for Pricing
View Details
Recombinant Polistes dominula Dominulin-A
MBS1040687-02 0.2 mg (E-Coli)

Recombinant Polistes dominula Dominulin-A

Sign In for Pricing
View Details
Recombinant Polistes dominula Dominulin-A
MBS1040687-03 0.5 mg (E-Coli)

Recombinant Polistes dominula Dominulin-A

Sign In for Pricing
View Details