Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DZIP1 Peptide - middle region

DZIP1 Peptide - middle region

Product Specifications

Product Name Alternative

DZIP, DZIPt1

UniProt

Q86YF9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055749.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGLRTMVEQNLME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TissueScan, Sarcoma cDNA Array II
HSRT502 10 Panels

TissueScan, Sarcoma cDNA Array II

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622329 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant FTO Antibody
RC-5059-01 50 μL

Recombinant FTO Antibody

Sign In for Pricing
View Details
Recombinant FTO Antibody
RC-5059-02 100 µL

Recombinant FTO Antibody

Sign In for Pricing
View Details
Recombinant FTO Antibody
RC-5059-03 1 mL

Recombinant FTO Antibody

Sign In for Pricing
View Details
EXD2 (NM_001193360) Human Over-expression Lysate
LY434339 100 µg

EXD2 (NM_001193360) Human Over-expression Lysate

Sign In for Pricing
View Details