Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPH3A Peptide - middle region

RPH3A Peptide - middle region

Product Specifications

UniProt

Q9Y2J0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001137326.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VSEPAAPEQPAPEPKHPARAPARGDSEDRRGPGQKTGPDPASAPGRGNYG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CPSF6 Antibody, Rabbit Polyclonal
MBS8102144-01 0.1 mL

Anti-CPSF6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CPSF6 Antibody, Rabbit Polyclonal
MBS8102144-02 5x 0.1 mL

Anti-CPSF6 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Carbonic Anhydrase 9/CA9 Rabbit pAb
APA1624-01 30 µL

Carbonic Anhydrase 9/CA9 Rabbit pAb

Sign In for Pricing
View Details
Carbonic Anhydrase 9/CA9 Rabbit pAb
APA1624-02 50 μL

Carbonic Anhydrase 9/CA9 Rabbit pAb

Sign In for Pricing
View Details
Carbonic Anhydrase 9/CA9 Rabbit pAb
APA1624-03 100 µL

Carbonic Anhydrase 9/CA9 Rabbit pAb

Sign In for Pricing
View Details
Randaiol
HY-N1531 1 Each

Randaiol

Sign In for Pricing
View Details