Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPRE3 Peptide - middle region

MAPRE3 Peptide - middle region

Product Specifications

Product Name Alternative

EB3, RP3, EBF3, EBF3-S

UniProt

Q9UPY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001289979.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Parkin Protein (PP) ELISA Kit
orb2809908-01 48 Tests

Human Parkin Protein (PP) ELISA Kit

Sign In for Pricing
View Details
Human Parkin Protein (PP) ELISA Kit
orb2809908-02 96 Tests

Human Parkin Protein (PP) ELISA Kit

Sign In for Pricing
View Details
Human Parkin Protein (PP) ELISA Kit
orb2809908-03 5 x 96 T

Human Parkin Protein (PP) ELISA Kit

Sign In for Pricing
View Details
PI3K p85 beta antibody
70R-50210 100 µL

PI3K p85 beta antibody

Sign In for Pricing
View Details
Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit
MBS9379120-01 48 Well

Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit

Sign In for Pricing
View Details
Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit
MBS9379120-02 96 Well

Porcine Serine/Threonine-Protein Phosphatase 1 Regulatory Subunit 10 (PPP1R10) ELISA Kit

Sign In for Pricing
View Details