Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPRE3 Peptide - middle region

MAPRE3 Peptide - middle region

Product Specifications

Product Name Alternative

EB3, RP3, EBF3, EBF3-S

UniProt

Q9UPY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001289979.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBP4 Antibody
orb1410044-01 20 µg

RBP4 Antibody

Sign In for Pricing
View Details
RBP4 Antibody
orb1410044-02 100 µg

RBP4 Antibody

Sign In for Pricing
View Details
RBP4 Antibody
orb1410044-03 100 ug (without BSA and Azide)

RBP4 Antibody

Sign In for Pricing
View Details
ARPC2 Conjugated Antibody
orb1620930 100 µL

ARPC2 Conjugated Antibody

Sign In for Pricing
View Details
Zirconium pyrophosphate
Z01425-01 25 g

Zirconium pyrophosphate

Sign In for Pricing
View Details
Zirconium pyrophosphate
Z01425-02 100 g

Zirconium pyrophosphate

Sign In for Pricing
View Details