Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIK Peptide - middle region

TNIK Peptide - middle region

Product Specifications

UniProt

Q9UKE5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001155032.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cervix
CS803550 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF488A conjugate, 0.1mg/mL
BNC880211-100 1x 100 µL

HCG-beta (hCGb/459), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ssh3 Mouse Gene Knockout Kit (CRISPR)
KN516764 1 Kit

Ssh3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dxd Rabbit Monoclonal Antibody [Clone ID: 1A12]
TA421202S 10 µg

Dxd Rabbit Monoclonal Antibody [Clone ID: 1A12]

Sign In for Pricing
View Details
Formic Acid-d
TRC-F692904-1G 1 g

Formic Acid-d

Sign In for Pricing
View Details
Recombinant Histone H2A (acetyl K9) Antibody
RC-16343-01 50 μL

Recombinant Histone H2A (acetyl K9) Antibody

Sign In for Pricing
View Details