Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNIK Peptide - middle region

TNIK Peptide - middle region

Product Specifications

UniProt

Q9UKE5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001155032.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDLVQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Glucono-1,5-lactone
TRC-G413305-500MG 500 mg

L-Glucono-1,5-lactone

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS637463 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
PKR (EIF2AK2) Rabbit Polyclonal Antibody
AP02771PU-N 100 µL

PKR (EIF2AK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM82A2 (RMDN3) Rabbit Polyclonal Antibody
TA362792 100 µL

FAM82A2 (RMDN3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDCD4 Recombinant Rabbit Monoclonal Antibody [JA80-83]
ET1704-70 100 µL

PDCD4 Recombinant Rabbit Monoclonal Antibody [JA80-83]

Sign In for Pricing
View Details
Human ADAMTS16 activation kit by CRISPRa
GA116222 1 Kit

Human ADAMTS16 activation kit by CRISPRa

Sign In for Pricing
View Details