Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FNBP1 Peptide - middle region

FNBP1 Peptide - middle region

Product Specifications

Product Name Alternative

FBP17

UniProt

Q96RU3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055848.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDIEFEDYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atrip Mouse Gene Knockout Kit (CRISPR)
KN501845 1 Kit

Atrip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chlormadinone Acetate
TRC-C343500-10MG 10 mg

Chlormadinone Acetate

Sign In for Pricing
View Details
High temperature cap (RED - PBT Plastic / up to 180C), GL45, 10/pk.
B3000-CAP-HTC 1 Each

High temperature cap (RED - PBT Plastic / up to 180C), GL45, 10/pk.

Sign In for Pricing
View Details
N Cadherin (CDH2) Goat Polyclonal Antibody
AB0071-200 600 µg

N Cadherin (CDH2) Goat Polyclonal Antibody

Sign In for Pricing
View Details
AMACR Rabbit Polyclonal Antibody
ER1706-60 100 µL

AMACR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details