CDK19 Peptide - middle region
CDK19 Peptide - middle region
Product Specifications
Product Name Alternative
CDK11, CDC2L6, bA346C16.3
UniProt
Q9BWU1
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001287889.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS8821804-01 48 Well
Human LFA3 (Lymphocyte Function Associated Antigen 3) ELISA Kit
Sign In for Pricing
View Details MBS8821804-02 96 Well
Human LFA3 (Lymphocyte Function Associated Antigen 3) ELISA Kit
Sign In for Pricing
View Details MBS8821804-03 5x 96 Well
Human LFA3 (Lymphocyte Function Associated Antigen 3) ELISA Kit
Sign In for Pricing
View Details MBS8821804-04 10x 96 Well
Human LFA3 (Lymphocyte Function Associated Antigen 3) ELISA Kit
Sign In for Pricing
View Details 
MBS2047702-01 0.1 mL
APC/CY7-Linked Polyclonal Antibody to Pregnancy Associated Plasma Protein A (PAPPA)
Sign In for Pricing
View Details MBS2047702-02 0.2 mL
APC/CY7-Linked Polyclonal Antibody to Pregnancy Associated Plasma Protein A (PAPPA)
Sign In for Pricing
View Details