Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDK19 Peptide - middle region

CDK19 Peptide - middle region

Product Specifications

Product Name Alternative

CDK11, CDC2L6, bA346C16.3

UniProt

Q9BWU1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001287889.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CQIPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCSK9 Antibody Pair Set
E-KAB-0061 50 µL & 100 µg

Human PCSK9 Antibody Pair Set

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) ELISA Kit
E-EL-M0727-01 24 Tests

Mouse IL-13 (Interleukin 13) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) ELISA Kit
E-EL-M0727-02 48 Tests

Mouse IL-13 (Interleukin 13) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-13 (Interleukin 13) ELISA Kit
E-EL-M0727-03 96 Tests

Mouse IL-13 (Interleukin 13) ELISA Kit

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF405S conjugate, 0.1mg/mL
BNC042083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ViPrimePLUS OneStep Taq RT-qPCR Green Master Mix I, 150rxns
QLMM14 150 Reactions

ViPrimePLUS OneStep Taq RT-qPCR Green Master Mix I, 150rxns

Sign In for Pricing
View Details